Home > www
>
Sheffieldwednesday.com
Sheffieldwednesday.com Website Linking Analysis for December 2024
Discovered Domains
2737
Discovered Links
6278
*sheffieldwednesday.com's discovered data are based on estimations from certain tests performed, and actual data may differ from these estimates.
Historic Data Overview
Last 6 months discovered total 61680 backlinks from 17837 referring domains.
| Month | Year | Discovered Domains | Discovered Links |
|---|---|---|---|
| July | 2024 | 3322 | 8597 |
| August | 2024 | 3939 | 14615 |
| September | 2024 | 2146 | 10891 |
| October | 2024 | 2643 | 13636 |
| November | 2024 | 3050 | 7663 |
| December | 2024 | 2737 | 6278 |
Free data API 🔗
Analysis Overview Data Chart
( Last 6 Months Data )
Discovered referring domains and URLs for December 2024
Showing 100 rows of 6278 results
| Referring Domains | Referring URLs |
|---|---|
| safelinkaing.blogspot.de | https://safelinkaing.blogspot.de/p/convert.html?id=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| semrush.com | http://semrush.com/info/sheffieldwednesday.com |
| o-safelink.blogspot.ru | https://o-safelink.blogspot.ru/2018/05/10-tips-for-starting-small-business.html?url=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| woorank.com | http://woorank.com/en/www/sheffieldwednesday.com |
| guru.sanook.com | https://guru.sanook.com/?URL=sheffieldwednesday.com |
| es.gunstoreusa.com | http://es.gunstoreusa.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| similarto.us | http://similarto.us/sheffieldwednesday.com |
| rbls.org | http://rbls.org/sheffieldwednesday.com |
| sheffieldwednesday.lyinh.com | http://sheffieldwednesday.lyinh.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| alpha.astroempires.com | http://alpha.astroempires.com/redirect.aspx?http://sheffieldwednesday.com |
| bookmerken.de | http://bookmerken.de/?url=http%3A%2F%2Fsheffieldwednesday.com |
| zh.circajewelry.com | http://zh.circajewelry.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| www.infoanda.com | http://www.infoanda.com/viewcomments.php?li=sheffieldwednesday.com |
| web.horde.to | http://web.horde.to/sheffieldwednesday.com |
| en-gb.earthspicestudio.com | http://en-gb.earthspicestudio.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| hi.invemetrics.net | http://hi.invemetrics.net/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| o-safelink.blogspot.com.br | https://o-safelink.blogspot.com.br/2018/05/10-tips-for-starting-small-business.html?url=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| mywot.com | http://mywot.com/scorecard/sheffieldwednesday.com |
| infoanda.com | http://infoanda.com/viewcomments.php?li=sheffieldwednesday.com |
| freetools.seobility.net | http://freetools.seobility.net/en/seocheck/sheffieldwednesday.com |
| blog.ss-blog.jp | https://blog.ss-blog.jp/_pages/mobile/step/index?u=sheffieldwednesday.com |
| encryptslink.blogspot.ae | https://encryptslink.blogspot.ae/p/go.html?url=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| securityheaders.com | http://securityheaders.com/?q=https%3A%2F%2Fsheffieldwednesday.com&followRedirects=on |
| en-us.jewricankitchen.com | http://en-us.jewricankitchen.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| usesafelink.blogspot.ca | https://usesafelink.blogspot.ca/p/go.html?url=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| o-safelink.blogspot.in | https://o-safelink.blogspot.in/2018/05/10-tips-for-starting-small-business.html?url=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| www.talgov.com | http://www.talgov.com/Main/exit?url=sheffieldwednesday.com |
| fark.com | http://fark.com/hlsearch?qq=http%3A%2F%2Fsheffieldwednesday.com |
| altavista.com | http://altavista.com/yhs/search?fr=altavista&itag=ody&kgs=0&kls=0&q=site:sheffieldwednesday.com |
| usesafelink.blogspot.jp | https://usesafelink.blogspot.jp/p/go.html?url=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| o-safelink.blogspot.ae | https://o-safelink.blogspot.ae/2018/05/10-tips-for-starting-small-business.html?url=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| nstools.fr | http://nstools.fr/sheffieldwednesday.com |
| en-gb.investinlosangeles.net | http://en-gb.investinlosangeles.net/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| addtoany.com | http://addtoany.com/share_save?linkname=&linkurl=sheffieldwednesday.com |
| hi.rainin-group.com | http://hi.rainin-group.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| sheffieldwednesday.rainin-group.com | http://sheffieldwednesday.rainin-group.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| ultimate-rihanna.com | http://ultimate-rihanna.com/?url=sheffieldwednesday.com |
| es.financetemp.com | http://es.financetemp.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| o-safelink.blogspot.jp | https://o-safelink.blogspot.jp/2018/05/10-tips-for-starting-small-business.html?url=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| allwebvalue.com | http://allwebvalue.com/siteinfo/sheffieldwednesday.com |
| en-us.lyinh.com | http://en-us.lyinh.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| sheffieldwednesday.innerpeacemusic.net | http://sheffieldwednesday.innerpeacemusic.net/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| safelinkaing.blogspot.co.id | https://safelinkaing.blogspot.co.id/p/convert.html?id=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| zh.lyinh.com | http://zh.lyinh.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| sheffieldwednesday.com.w3lookup.net | http://sheffieldwednesday.com.w3lookup.net |
| www.civicvoice.org.uk | http://www.civicvoice.org.uk/?URL=sheffieldwednesday.com/ |
| whois.ws | http://whois.ws/whois/sheffieldwednesday.com |
| serpanalytics.com | http://serpanalytics.com/sites/sheffieldwednesday.com |
| es.phrma.org | http://es.phrma.org/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| en-us.cyclebargain.com | http://en-us.cyclebargain.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| es.cyclebargain.com | http://es.cyclebargain.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| zh.saas-providers.info | http://zh.saas-providers.info/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| casafelink2.blogspot.com.au | https://casafelink2.blogspot.com.au/p/convert.html?id=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| sitereport.netcraft.com | https://sitereport.netcraft.com/?url=sheffieldwednesday.com |
| sites.ipaddress.com | http://sites.ipaddress.com/sheffieldwednesday.com/ |
| viewwhois.com | http://viewwhois.com/sheffieldwednesday.com/ |
| o-safelink.blogspot.co.id | https://o-safelink.blogspot.co.id/2018/05/10-tips-for-starting-small-business.html?url=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| o-safelink.blogspot.be | https://o-safelink.blogspot.be/2018/05/10-tips-for-starting-small-business.html?url=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| civicvoice.org.uk | http://civicvoice.org.uk/?URL=sheffieldwednesday.com/ |
| sheffieldwednesday.avoyacruises.com | http://sheffieldwednesday.avoyacruises.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| whois.chromefans.org | http://whois.chromefans.org/sheffieldwednesday.com |
| en-gb.avoyacruises.com | http://en-gb.avoyacruises.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| www.siteworthcalculators.com | http://www.siteworthcalculators.com/sheffieldwednesday.com |
| encryptslink.blogspot.it | https://encryptslink.blogspot.it/p/go.html?url=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| fr.lyinh.com | http://fr.lyinh.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| fr.ricefamily.com | http://fr.ricefamily.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| usesafelink.blogspot.com.br | https://usesafelink.blogspot.com.br/p/go.html?url=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| en-us.financetemp.com | http://en-us.financetemp.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| ahref.org | http://ahref.org/app/lc/?sheffieldwednesday.com |
| en-us.gunstoreusa.com | http://en-us.gunstoreusa.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| hqindex.org | http://hqindex.org/sheffieldwednesday.com |
| casafelink2.blogspot.co.uk | https://casafelink2.blogspot.co.uk/p/convert.html?id=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| a.pr-cy.ru | http://a.pr-cy.ru/sheffieldwednesday.com/ |
| usesafelink.blogspot.my | https://usesafelink.blogspot.my/p/go.html?url=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| en-us.phrma.org | http://en-us.phrma.org/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| en-gb.railinfo.net | http://en-gb.railinfo.net/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| encryptslink.blogspot.in | https://encryptslink.blogspot.in/p/go.html?url=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| listenarabic.com | http://listenarabic.com/search?q=sheffieldwednesday.com&sa=Search |
| zh.jewricankitchen.com | http://zh.jewricankitchen.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| www.ibm.com | http://www.ibm.com/links/?cc=us&lc=en&prompt=1&url=//sheffieldwednesday.com |
| w3techs.com | http://w3techs.com/sites/info/sheffieldwednesday.com |
| proza.ru | http://proza.ru/go/sheffieldwednesday.com |
| ranking.crawler.com | http://ranking.crawler.com/SiteInfo.aspx?url=sheffieldwednesday.com/ |
| en-gb.bigthings.com | http://en-gb.bigthings.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| sheffieldwednesday.financetemp.com | http://sheffieldwednesday.financetemp.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| redirects.tradedoubler.com | http://redirects.tradedoubler.com/utm/td_redirect.php?td_keep_old_utm_value=1&url=https%3A%2F%2Fsheffieldwednesday.com |
| foro.infojardin.com | https://foro.infojardin.com/proxy.php?link=sheffieldwednesday.com |
| fr.logicatwork.net | http://fr.logicatwork.net/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| safelinkaing.blogspot.jp | https://safelinkaing.blogspot.jp/p/convert.html?id=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| onfry.com | http://onfry.com/social/?url=sheffieldwednesday.com |
| w3seo.info | http://w3seo.info/WSZScore/sheffieldwednesday.com/ |
| web.archive.org | http://web.archive.org/web/*/sheffieldwednesday.com/ |
| en-us.aafacepainting.com | http://en-us.aafacepainting.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| casafelink2.blogspot.be | https://casafelink2.blogspot.be/p/convert.html?id=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| minecraft.curseforge.com | http://minecraft.curseforge.com/linkout?remoteUrl=http%3A%2F%2Fsheffieldwednesday.com |
| en-gb.financetemp.com | http://en-gb.financetemp.com/__media__/js/netsoltrademark.php?d=sheffieldwednesday.com |
| safelinkaing.blogspot.co.uk | https://safelinkaing.blogspot.co.uk/p/convert.html?id=aHR0cDovL3NoZWZmaWVsZHdlZG5lc2RheS5jb20= |
| siteworthtraffic.com | http://siteworthtraffic.com/report/sheffieldwednesday.com |
| isitblockedinrussia.com | http://isitblockedinrussia.com/?host=https%3A%2F%2Fsheffieldwednesday.com |
Historic Data Chart
These charts show the number of referring domains and links discovered every month.
Referring Domains
Discovered total: 17837
Referring URLs
Discovered total: 61680
Domains with same name
Sheffieldwednesday.com full domain length 22 including vowels 7(31.82%), consonants 14(63.64%), digits 0(0.00%), dots 1(4.55%) & hyphens 0(0.00%). Here is 20 domains with same name (sheffieldwednesday) with dfferent TLDs.
| Domain | TLD | July - Discovered Domains | July - Discovered Links | August - Discovered Domains | August - Discovered Links | September - Discovered Domains | September - Discovered Links | October - Discovered Domains | October - Discovered Links | November - Discovered Domains | November - Discovered Links | December - Discovered Domains | December - Discovered Links |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Sheffieldwednesday.com | .com | 3322 | 8597 | 3939 | 14615 | 2146 | 10891 | 2643 | 13636 | 3050 | 7663 | 2737 | 6278 |
| sheffieldwednesday.net | .net | 2317 | 9761 | 3941 | 10447 | 4495 | 12253 | 4691 | 10929 | 3929 | 7712 | 3488 | 11491 |
| sheffieldwednesday.org | .org | 3025 | 8255 | 2202 | 7147 | 2167 | 13895 | 3078 | 8727 | 4654 | 14462 | 2405 | 13946 |
| sheffieldwednesday.info | .info | 4588 | 11103 | 2265 | 9008 | 4967 | 5364 | 4613 | 10235 | 2767 | 13118 | 2965 | 8764 |
| sheffieldwednesday.biz | .biz | 2066 | 7911 | 3905 | 13470 | 4118 | 6150 | 3418 | 13587 | 4914 | 12351 | 2832 | 12465 |
| sheffieldwednesday.mobi | .mobi | 4168 | 14347 | 3712 | 11504 | 2481 | 5731 | 3609 | 14612 | 3556 | 12487 | 2768 | 8358 |
| sheffieldwednesday.xyz | .xyz | 2480 | 11792 | 3158 | 5830 | 4365 | 6614 | 2911 | 13064 | 4643 | 14431 | 2538 | 9953 |
| sheffieldwednesday.site | .site | 2105 | 13607 | 3188 | 11652 | 3213 | 13345 | 4704 | 8064 | 3148 | 10093 | 3401 | 11899 |
| sheffieldwednesday.top | .top | 2310 | 7235 | 3350 | 9584 | 3603 | 7711 | 3304 | 11518 | 4366 | 13603 | 2355 | 13423 |
| sheffieldwednesday.digital | .digital | 3794 | 9967 | 3889 | 14843 | 2742 | 9386 | 2523 | 5519 | 3799 | 9818 | 3780 | 7618 |
| sheffieldwednesday.global | .global | 3239 | 14260 | 2188 | 8599 | 4434 | 5280 | 2920 | 13748 | 4726 | 13758 | 4659 | 5940 |
| sheffieldwednesday.best | .best | 3295 | 13593 | 2531 | 8750 | 2538 | 10729 | 3110 | 13779 | 2027 | 11061 | 4001 | 6031 |
| sheffieldwednesday.one | .one | 3612 | 5119 | 2331 | 6505 | 3526 | 6782 | 3980 | 14339 | 2647 | 14280 | 4265 | 10108 |
| sheffieldwednesday.blog | .blog | 4290 | 7891 | 2401 | 5819 | 4472 | 12951 | 4340 | 13192 | 4824 | 10036 | 4665 | 7658 |
| sheffieldwednesday.website | .website | 2615 | 9027 | 2711 | 7627 | 4262 | 10424 | 2885 | 14727 | 4438 | 8611 | 3835 | 6128 |
| sheffieldwednesday.online | .online | 4078 | 6933 | 2150 | 14724 | 3322 | 13215 | 4706 | 11721 | 3511 | 13696 | 3811 | 6150 |
| sheffieldwednesday.co | .co | 2489 | 9435 | 2702 | 12157 | 3479 | 7352 | 3038 | 8227 | 4476 | 9161 | 2318 | 12738 |
| sheffieldwednesday.fun | .fun | 3916 | 8603 | 3924 | 13275 | 3553 | 13330 | 3137 | 9609 | 4280 | 5992 | 4886 | 9973 |
| sheffieldwednesday.ooo | .ooo | 4184 | 5565 | 4293 | 14736 | 3988 | 8050 | 4902 | 7742 | 3698 | 10131 | 4814 | 9536 |
| sheffieldwednesday.pro | .pro | 3121 | 10171 | 3645 | 9312 | 4330 | 11167 | 2663 | 12337 | 2664 | 6528 | 4453 | 12849 |